Web Analytics
518-831-8000 sales@utechproducts.com

ZC3H12A Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ZC3H12A, Each

1,757.70

Details:

ZC3H12A is an MCP1 (CCL2; MIM 158105)-induced protein that acts as a transcriptional activator and causes cell death of cardiomyocytes, possibly via induction of genes associated with apoptosis.[supplied by OMIMSequence: AFPPREYWSEPYPLPPPTSVLQEPPVQSPGAGRSPWGRAGSLAKEQASVYTKLCGVFPPHLVEAVMGRFPQLLDPQQLAAEILSYKSQHPS

Additional Information

SKU 10288649
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22605