Web Analytics
518-831-8000 sales@utechproducts.com

ZDHHC15, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ZDHHC15, Each

1,757.70

Details:

The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: VSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQ

Additional Information

SKU 10287329
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21089