Zdhhc15, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Zdhhc15, Each

Details:

The protein encoded by this gene belongs to the dhhc palmitoyltransferase family. Mutations in this gene are associated with mental retardatio x-linked type 91 (mrx91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: vsrnkttleafctpvftsgpekngfnlgfikniqqvfgdkkkfwlipigsspgdghsfpmrsmnesqnpllaneetwedneddnq