Web Analytics
518-831-8000 sales@utechproducts.com

Zdhhc15, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Zdhhc15, Each

$ 1,757.70

Details

The protein encoded by this gene belongs to the dhhc palmitoyltransferase family. Mutations in this gene are associated with mental retardatio x-linked type 91 (mrx91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: vsrnkttleafctpvftsgpekngfnlgfikniqqvfgdkkkfwlipigsspgdghsfpmrsmnesqnpllaneetwedneddnq

Additional Information

SKU 10287329
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21089