Zfy, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Zfy, Each
$ 1,750.95
|
|
Details:
This gene encodes a zinc finger-containing protein that may function as a transcription factor. This gene was once a candidate gene for the testis-determining factor (tdf) and was erroneously referred to as tdf. [Provided by refseqsequence: igpdghpltvypcmicgkkfksrgflkrhmknhpehlakkkyhctdcdyttnkkislhnhleshkltskaekaiecdecgkhfshagalfthkmvhkekgankmhkckfceyetaeqgllnrhl
Additional Information
| SKU | 10286451 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20081 |
