Zfyve1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Zfyve1, Each

Details:

The fyve domain mediates the recruitment of proteins involved in membrane trafficking and cell signaling to phosphatidylinositol 3-phosphate (ptdins(3)p)-containing membranes. This gene encodes a protein which contains two zinc-binding fyve domains in tandem. This protein displays a predominantly golgi, endoplasmic reticulum and vesicular distribution. Alternatively spliced transcript variants have been found for this gene, and they encode two isoforms with different sizes. [Provided by refseqsequence: iapaywrpnsqilscnkcatsfkdndtkhhcracgegfcdscssktrpvpergwgpapvrvcdncyearnvqlavteaqvddeggtliarkvgeavqntlgavvtaidiplglvkdaarpaywvpdheilhchncrkefsiklskhh