Zmiz2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Zmiz2, Each

Details:

Zmiz2 and zmiz1 (mim 607159) are members of a pias (see mim 603566)-like family of proteins that interact with nuclear hormone receptors. Zmiz2 interacts with androgen receptor (ar; mim 313700) and enhances ar-mediated transcription (huang et al., 2005 [Pubmed 16051670]).[Supplied by omimsequence: lmpsvmemiaalgpgaapfaplqppsvpapsdypgqgssflgpgtfpesfppttpstptlaeftpgpppisyqsdipsslltsekstaclpsqmapaghldpthnpgtpglhtsnl