Znf235, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Znf235, Each
$ 1,757.70
|
|
Details:
This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein is a member of the kruppel family of zinc finger proteins, and contains kruppel-associated box (krab) a and b domains and 15 tandemly arrayed c2h2-type zinc fingers. It is an ortholog of the mouse zfp93 protein. This gene is located in a cluster of zinc finger genes on 19q13.2. [Provided by refseqsequence: asvddnclvnhigdhssiienqefptgkvpnswskiylnetqnyqrsckqtqmknklcifapyvdifscishhh
Additional Information
| SKU | 10290102 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24428 |
