Web Analytics
518-831-8000 sales@utechproducts.com

ZNF443, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ZNF443, Each

1,757.70

Details:

Zinc finger proteins (ZNFs) bind DNA and, through this binding, regulate gene transcription. Most ZNFs contain conserved C2H2 motifs and are classified as Kruppel-type zinc fingers. For a general of these proteins, see ZNF91 (MIM 603971).[supplied by OMIMSequence: VALEDVAVNFTREEWALLGPCQKNLYKDVMQETIRNLDCVVMKWKDQNIEDQYRYPRKNLRCRMLERFVESKDGTQCGETSSQIQDSIVTKNTLPGVGPCESSMRGEKVMGHSSLNCYIRVGA

Additional Information

SKU 10286535
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20171